PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009859P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 515aa    MW: 56233.2 Da    PI: 6.0606
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009859P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.76.9e-40152212262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  MELO3C009859P1 152 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSA 212
                     7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-31149209IPR003851Zinc finger, Dof-type
PfamPF027012.9E-32154210IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.947156210IPR003851Zinc finger, Dof-type
PROSITE patternPS013610158194IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MSEPKDPAIK LFGKTIPLPE PSPATPHLPS SSLPIPTPAD HTTAVANHDH DSSSSTLSPE  60
ANIDVDGEDL EVDKDAISEK SGGTKLEDRD GDGDGDGGLS VSTEEFTNSD TSVVKTENSK  120
VLSGEESNPS STTKTDEQNE TSNSQEKTLK KPDKILPCPR CNSMDTKFCY YNNYNVNQPR  180
HFCKNCQRYW TAGGTMRNVP VGAGRRKNKS SASHHRQIIV SEALQHARTD VPNGIHHSTL  240
KPNGNVLAFG SDAPLCESMA SILNIADKTR QNSTRNGFQK PEALKIPVAY ENGENDDQSQ  300
ESAPTPFINN EEGKTGPQDQ VIHNCQGFLP PHVPFFPGTP WPYPWNSPQW SSPVPPPTFY  360
PPGIPMPFYP TAPFWGCTVP GAWPIPWVSQ PPPLSPVAQN HAPNSPTLGK HSRDENVTKQ  420
SDFGEHEQQK DNKTEKCLWI PKTLRIDDPG EAAKSSIWAT LGIKNDKTDS VSEGLFKAFQ  480
SKKIDEKNHK TEASPVLQVN PAALSRSIKF HESS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443398.10.0PREDICTED: cyclic dof factor 2
TrEMBLA0A0A0LG120.0A0A0A0LG12_CUCSA; Uncharacterized protein
STRINGVIT_14s0108g00980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-112cycling DOF factor 2